PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.244650.1
Common NameCsa_3G199590, LOC101204047
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 114aa    MW: 13284.9 Da    PI: 10.3771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.244650.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-171257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll  +v+  G ++W++I++ +  gR++k+c++rw++ 
   Cucsa.244650.1 12 KGPWSPEEDLLLRMLVQDQGARNWSLISQSIH-GRSGKSCRLRWFNQ 57
                     79******************************.***********996 PP

2Myb_DNA-binding59.76.2e-1964108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eEd  +vda++ +G++ W+tIar ++ gRt++ +k++w++ 
   Cucsa.244650.1  64 RRPFTPEEDAFIVDAHRIYGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      679*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.726758IPR017930Myb domain
SuperFamilySSF466892.45E-319105IPR009057Homeodomain-like
SMARTSM007173.9E-111160IPR001005SANT/Myb domain
PfamPF002498.6E-171257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-241365IPR009057Homeodomain-like
CDDcd001674.33E-121456No hitNo description
PROSITE profilePS5129424.48159113IPR017930Myb domain
SMARTSM007178.0E-1663111IPR001005SANT/Myb domain
PfamPF002491.1E-1564108IPR001005SANT/Myb domain
CDDcd001675.36E-1266109No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MPSVHPDIDR VKGPWSPEED LLLRMLVQDQ GARNWSLISQ SIHGRSGKSC RLRWFNQLCP  60
GLDRRPFTPE EDAFIVDAHR IYGNKWATIA RLLNGRTDNA IKNHWNSTLK RKYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-3891124107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818511e-125LN681851.1 Cucumis melo genomic scaffold, anchoredscaffold00038.
GenBankLN7132601e-125LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140809.12e-80PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-50MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0LA792e-80A0A0A0LA79_CUCSA; Uncharacterized protein
STRINGVIT_03s0180g00210.t012e-53(Vitis vinifera)
STRINGPGSC0003DMT4000643067e-53(Solanum tuberosum)
STRINGGSMUA_Achr3P13070_0012e-53(Musa acuminata)
STRINGGSMUA_Achr4P20150_0011e-53(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-53myb domain protein 70
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]